Pinterest

Today
Watch
Shop
Explore
When autocomplete results are available use up and down arrows to review and enter to select. Touch device users, explore by touch or with swipe gestures.

Thm desserts

Discover Pinterest’s 10 best ideas and inspiration for Thm desserts. Get inspired and try out new things.
How to Make Amazing Low Carb Peanut Butter Brownies | My Montana
Saved from mymontanakitchen.com

How to Make Amazing Low Carb Peanut Butter Brownies | My Montana

Rich, fudgy, and bursting with peanut butter flavor, these decadent Low Carb Peanut Butter Brownies will soon be a new family favorite.

Keto Desserts
Desserts Sains
Sugar Free Desserts
Low Carb Recipes Dessert
Sugar Free Recipes
Low Carb Keto Recipes
Thm Recipes
Holiday Desserts
Keto Snacks
Veronica Mock
Veronica Mock saved to thm desserts
10 Trim Healthy Mama Lemon Recipes - Northern Nester
Saved from northernnester.com

10 Trim Healthy Mama Lemon Recipes - Northern Nester

10 Trim Healthy Mama Lemon recipes featurung low-carb, gluten-free muffins, cakes, mousse, sippers, curds, and bars without special ingredients.

Banana Recipes Clean Eating
Trim Healthy Recipes
Healthy Recipes Easy Snacks
Thm Recipes
Cream Recipes
Healthy Food
Lemon Recipes Sweet
Lemon Dessert Recipes
Amanda Morgan
Amanda Morgan saved to Trim Healthy Mama
12 Easy & Impressive Low-Carb Spring Desserts
Saved from northernnester.com

12 Easy & Impressive Low-Carb Spring Desserts

You'll feel anything but deprived with a selection from these 12 incredibly easy and impressive low-carb Spring desserts! Suitable for THM, Keto, GF diets.

Strawberry Pretzel Dessert
Pretzel Desserts
Keto Dessert Recipes
Strawberry Recipes
Low Carb Desserts
Baking Recipes
Healthy Desserts
Strawberry Jello
Strawberry Shortcake
Denise BaldwinD
Denise Baldwin saved to Keto/low carb/sugar free
The Ultimate Trim Healthy Mama Cheesecake Round-Up
Saved from northernnester.com

The Ultimate Trim Healthy Mama Cheesecake Round-Up

2 · The ultimate Trim Healthy Mama Cheesecake Round-Up, with low-carb cheesecake baking tips, and over 30 of the very best Trim Healthy Mama cheesecake recipes!

Ingredients

Refrigerated
  • • 1 Egg white
Baking & Spices
  • • 4 tbsp Xylitol
Nuts & Seeds
  • • 1 1/2 cups Nut
Dairy
  • • 3 tbsp Butter
Trim Healthy Mama Cheesecake
Low Carb Cheesecake
Cheesecake Recipes
Thm Desserts
Low Carb Recipes Dessert
Thm Recipes
Cream Recipes
Healthy Low Carb Recipes
Sweets
Brenda HessB
Brenda Hess saved to THM
THM Buckeye Brownies
Saved from northernnester.com

THM Buckeye Brownies

17 · 60 minutes · These Buckeye Brownies are the pinnacle of low-carb brownie recipes! The chewy brownie base alone is worth eating by itself, but the Peanut Butter Cheesecake layer takes it to a whole new level of awesomeness! A rich, decadent THM S.

Ingredients

Refrigerated
  • • 3 Eggs
Condiments
  • • 3/4 cup Peanut butter, sugar-free
  • • 1 pinch Stevia
Baking & Spices
  • • 1 3.5 oz bar 85% dark chocolate
  • • 1 cup Almond flour
  • • 1/3 Bar 85% chocolate
  • • 1/4 cup Cocoa powder
  • • 1 pinch Mineral salt
  • • 1 tsp Vanilla extract
  • • 1 1/2 cup Xylitol
Drinks
  • • 1 tsp Espresso, powder
Dairy
  • • 1/2 cup Butter
  • • 1 8oz. pkg. Cream cheese
  • • 7/8 cup Heavy cream
Trim Healthy Recipes
Thm Recipes
Low Carb Yum
Healthy Dessert Recipes
Dinner Recipes
Quick Healthy
Appetizers
Low Carb Desserts
Lori
Lori saved to Thm
This Peanut Butter Pie Delight is basically my mom's peanut butter cream pie, but there's no need to mess with pie crust and it's low carb and sugar free (THM S)! #brianathomas #trimhealthymama #thm #lowcarb #sugarfree #glutenfree #sugarfreedessertrecipes #peanutbutterpie #creampie
Saved from briana-thomas.com

Low Carb Peanut Butter Pie Delight - THM S, sugar free, gluten free

2 · 56 minutes · This Peanut Butter Pie Delight is basically my mom's peanut butter cream pie, but there's no need to mess with pie crust and it's low carb and sugar free! THM S "I could eat those crumbles till the cows come home!" - Ryan If this sounds like a lot to do all at once, you can make the crust, pudding, and crumbs in advance as you have time, then make the whipped cream right before assembly. I actually prefer this Peanut Butter Pie Delight after it's been assembled and refrigerated overnight, so…

Ingredients

Refrigerated
  • • 4 Egg yolks
Condiments
  • • 4 1/2 tbsp Peanut butter, natural
Baking & Spices
  • • 1 cup Briana's baking mix
  • • 6 tbsp Defatted peanut flour
  • • 8 tbsp Oat fiber
  • • 3/8 tsp Salt
  • • 1 Pinch Salt
  • • 2 tsp Vanilla extract
  • • 1 Dash Vanilla extract
  • • 1/8 tsp Xanthan gum
  • • 7 tbsp Xylitol
Dairy
  • • 2 cups Almond or cashew milk, unsweetened
  • • 9 tbsp Butter, salted
  • • 1 1/2 cup Double creme
Desserts
  • • 2 tsp Knox gelatin
Liquids
  • • 2 tbsp Tap water
Other
  • • 1/16 teaspoon (2 doonks) THM Pure Stevia Extract Powder
  • • ¾ teaspoon glucomannan
  • • 2 ½ tablespoons THM Super Sweet Blend (or more, to taste)
Sugar Free Desserts
Sugar Free Recipes
Keto Dessert Recipes
Low Carb Desserts
Diabetic Desserts
Sweets Recipes
Recipes Dinner
Peanut Butter Cream Pie
Sugar Free Peanut Butter
Briana Thomas
Briana Thomas saved to Briana's THM Desserts
22 Trim Healthy Mama Muffin In A Mug Recipes - Northern Nester
Saved from northernnester.com

22 Trim Healthy Mama Muffin In A Mug Recipes

A collection of 22 Trim Healthy Mama Muffin In A Mug recipes that are sweet, savory, and simple! All it takes is 3 minutes to whip up an on-plan snack!

Thm Desserts
Delicious Desserts
Dessert Recipes
Low Carb Deserts
Low Carb Treats
Mug Recipes
Low Carb Recipes
Cake Recipes
Desert Recipes
Sacred Milk Keepsake
Sacred Milk Keepsake saved to THM (S) desserts
No Special Ingredient THM Dessert
Saved from northernnester.com

No Special Ingredient THM Dessert

2 · Low-carb custard sauce is the perfect alternative to whipped cream or Greek yogurt when you need a protein source for a berry-filled snack or dessert. Gluten-free and a Trim Healthy Mama S, this low-carb custard sauce

Ingredients

Refrigerated
  • • 3 Egg yolks
Baking & Spices
  • • 1 tsp Vanilla extract
  • • 4 tbsp Xylitol
Dairy
  • • 1 1/2 cups Whipping cream
Trim Healthy Mama Menus
Trim Healthy Recipes
Trim Healthy Momma
Thm Recipes
Smoothie Recipes
Low Carb Sweets
Low Carb Desserts
Free Desserts
Healthy Desserts
Michelle Garrigan
Michelle Garrigan saved to Low Carb
Perfect THM Peanut Butter Blossoms {Recipe} | My Joy in Chaos
Saved from myjoyinchaos.com

Perfect THM Peanut Butter Blossoms {Recipe} | My Joy in Chaos

3 · 20 minutes · A low-carb, sugar-free, THM version of the classic Peanut Butter Blossom cookie

Ingredients

Refrigerated
  • • 3 Eggs
Condiments
  • • 1 tsp Blackstrap molasses
  • • 1/2 cup Peanut butter, natural
Baking & Spices
  • • 1 tsp Baking powder
  • • 1 tsp Baking soda
  • • 1 Chocolate, sugar-free discs
  • • 1 tsp Mineral salt
  • • 1/2 cup Oat fiber
  • • 1 tbsp Vanilla
Dairy
  • • 1/2 cup Butter, salted or unsalted
Other
  • • 1 cup Baking blend
  • • 1 1/4 cup Thm gentle sweet
Trim Healthy Mama Diet
Trim Healthy Recipes
Thm Recipes
Baking Recipes
Dessert Recipes
Low Carb Desserts
Healthy Desserts
Soft Chocolate Chip Cookies
Chocolate Desserts
Pamela Withrow
Pamela Withrow saved to Trim Healthy Mama
Chocolate Peanut Butter Cookies | My Montana Kitchen
Saved from mymontanakitchen.com

Chocolate Peanut Butter Cookies | My Montana Kitchen

Soft, a little chewy and a little cakey, these sweet Chocolate Peanut Butter Cookies are filled with chocolate flavor and perfect with a cup of coffee.

Keto Friendly Desserts
Sugar Free Desserts
Low Carb Recipes Dessert
Sugar Free Recipes
Keto Dessert Recipes
Paleo Dessert
Diabetic Desserts
Diabetic Recipes
Keto Cookies
Irene Wanner
Irene Wanner saved to THM FP

Watch popular Thm desserts videos

Low Carb Holiday desserts, sides, candy, cookies, fudge and more! Over 60 recipes included in this printable PDF! Great for Thanksgiving, Christmas, and all Holidays! #lowcarbholiday #ketochristmasrecipes
Ok, this is almost no-bake…you do bake the crust a bit. But other than that it’s a super simple, creamy, no-bake chocolate chip cheesecake recipe with a peanut buttery crust. This low carb and sugar-free dessert is perfect for Trim Healthy Mamas to take to potlucks and family gatherings, too! | Oh Sweet Mercy @ohsweetmercy #trimhealthymamadesserts #trimhealthymamaholdiaydesserts #ketonobakedesserts #sugarfreenobakedesserts #healthydessertrecipes #healthyfalldessertrecipes #ohsweetmercy
Creamy apple salad, with a hint of peanut butter, that’s perfect for Autumn and THM E friendly! It’s low fat and contains the healthy carbs we need to nourish our bodies and slim down. Great as a snack, dessert, or potluck offering. We’re finally into my favorite time of year — Autumn…or Fall, whichever you like to call it. That means cooler days, crunchy leaves, and crisp, ripe apples. | Oh Sweet Mercy @ohsweetmercy #trimhealthymamafallsidedish #trimhealthymamathanksgivignrecipes #ohsweetmercy
Easy No-Bake Peanut Butter Cookies Recipe